Product Browser

Last updated: 2021/11/28
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

ABCF2 monoclonal antibody (M01), clone 1D11 

  • Catalog # : H00010061-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant ABCF2.
  • Immunogen:
  • ABCF2 (AAH01661, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010061-M01
    Western Blot detection against Immunogen (37.73 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • ABCF2 monoclonal antibody (M01), clone 1D11 Western Blot analysis of ABCF2 expression in Hela ( Cat # L013V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ABCF2 expression in transfected 293T cell line by ABCF2 monoclonal antibody (M01), clone 1D11.

    Lane 1: ABCF2 transfected lysate(68.53 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlargeenlarge this image
  • Immunoperoxidase of monoclonal antibody to ABCF2 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml]
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of ABCF2 transfected lysate using anti-ABCF2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ABCF2 monoclonal antibody.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged ABCF2 is approximately 0.3ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • Western blot analysis of ABCF2 over-expressed 293 cell line, cotransfected with ABCF2 Validated Chimera RNAi ( Cat # H00010061-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ABCF2 monoclonal antibody (M01), clone 1D11 (Cat # H00010061-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • enlarge
  • Gene Information
  • Gene Name:
  • ABCF2
  • Gene Alias:
  • ABC28,DKFZp586K1823,EST133090,HUSSY-18,HUSSY18,M-ABC1
  • Gene Description:
  • ATP-binding cassette, sub-family F (GCN20), member 2
  • Gene Summary:
  • The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This protein is a member of the GCN20 subfamily. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq
  • Other Designations:
  • ABC-type transport protein,ATP-binding cassette, sub-family F, member 2,Iron inhibited ABC transporter 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook