FARSLB monoclonal antibody (M01), clone 2F11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
FARSLB monoclonal antibody (M01), clone 2F11 Western Blot analysis of FARSLB expression in HepG2 ( Cat # L019V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to FARSLB on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 3 ug/ml]
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to FARSLB on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 3 ug/ml]
Western Blot detection against Immunogen (37.62 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FARSLB.
Immunogen
FARSLB (NP_005678, 234 a.a. ~ 341 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PPIINGDHSRITVNTRNIFIECTGTDFTKAKIVLDIIVTMFSEYCENQFTVEAAEVVFPNGKSHTFPELAYRKEMVRADLINKKVGIRETPENLAKLLTRMYLKSEVI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (93)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FARSLB monoclonal antibody (M01), clone 2F11 Western Blot analysis of FARSLB expression in HepG2 ( Cat # L019V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to FARSLB on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 3 ug/ml]Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to FARSLB on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 3 ug/ml]ELISA
-
Gene Info — FARSB
Entrez GeneID
10056GeneBank Accession#
NM_005687Protein Accession#
NP_005678Gene Name
FARSB
Gene Alias
FARSLB, FRSB, HSPC173, PheHB, PheRS
Gene Description
phenylalanyl-tRNA synthetase, beta subunit
Omim ID
609690Gene Ontology
HyperlinkGene Summary
This gene encodes a highly conserved enzyme that belongs to the aminoacyl-tRNA synthetase class IIc subfamily. This enzyme comprises the regulatory beta subunits that form a tetramer with two catalytic alpha subunits. In the presence of ATP, this tetramer is responsible for attaching L-phenylalanine to the terminal adenosine of the appropriate tRNA. A pseudogene located on chromosome 10 has been identified. [provided by RefSeq
Other Designations
phenylalanine tRNA ligase 1, beta, cytoplasmic|phenylalanine-tRNA ligase beta chain|phenylalanine-tRNA synthetase-like, beta subunit|phenylalanyl-tRNA synthetase beta-subunit|phenylalanyl-tRNA synthetase-like, beta subunit
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Bi-allelic Mutations in Phe-tRNA Synthetase Associated with a Multi-system Pulmonary Disease Support Non-translational Function.
Xu Z, Lo WS, Beck DB, Schuch LA, Oláhová M, Kopajtich R, Chong YE, Alston CL, Seidl E, Zhai L, Lau CF, Timchak D, LeDuc CA, Borczuk AC, Teich AF, Juusola J, Sofeso C, Müller C, Pierre G, Hilliard T, Turnpenny PD, Wagner M, Kappler M, Brasch F, Bouffard JP, Nangle LA, Yang XL, Zhang M, Taylor RW, Prokisch H, Griese M, Chung WK, Schimmel P.
American Journal of Human Genetics 2018 Jul; 103(1):100.
Application：WB-Ce, Human, Human skin fibroblasts.
-
Bi-allelic Mutations in Phe-tRNA Synthetase Associated with a Multi-system Pulmonary Disease Support Non-translational Function.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com