Product Browser

Last updated: 2017/10/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FARSLB monoclonal antibody (M01), clone 2F11

  • Catalog # : H00010056-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant FARSLB.
  • Immunogen:
  • FARSLB (NP_005678, 234 a.a. ~ 341 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • PPIINGDHSRITVNTRNIFIECTGTDFTKAKIVLDIIVTMFSEYCENQFTVEAAEVVFPNGKSHTFPELAYRKEMVRADLINKKVGIRETPENLAKLLTRMYLKSEVI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010056-M01
    Western Blot detection against Immunogen (37.62 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • FARSLB monoclonal antibody (M01), clone 2F11 Western Blot analysis of FARSLB expression in HepG2 ( Cat # L019V1 ).
  • PDF DownloadProtocol Download
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlargeenlarge this image
  • Immunoperoxidase of monoclonal antibody to FARSLB on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 3 ug/ml]
  • PDF DownloadProtocol Download
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlargeenlarge this image
  • Immunoperoxidase of monoclonal antibody to FARSLB on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 3 ug/ml]
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • FARSB
  • Gene Alias:
  • FARSLB,FRSB,HSPC173,PheHB,PheRS
  • Gene Description:
  • phenylalanyl-tRNA synthetase, beta subunit
  • Gene Summary:
  • This gene encodes a highly conserved enzyme that belongs to the aminoacyl-tRNA synthetase class IIc subfamily. This enzyme comprises the regulatory beta subunits that form a tetramer with two catalytic alpha subunits. In the presence of ATP, this tetramer is responsible for attaching L-phenylalanine to the terminal adenosine of the appropriate tRNA. A pseudogene located on chromosome 10 has been identified. [provided by RefSeq
  • Other Designations:
  • phenylalanine tRNA ligase 1, beta, cytoplasmic,phenylalanine-tRNA ligase beta chain,phenylalanine-tRNA synthetase-like, beta subunit,phenylalanyl-tRNA synthetase beta-subunit,phenylalanyl-tRNA synthetase-like, beta subunit
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook