SAE1 monoclonal antibody (M01), clone 1G4-1G5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant SAE1.
Immunogen
SAE1 (AAH00344, 1 a.a. ~ 346 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (91)
Isotype
IgG1 lambda
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (63.8 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SAE1 monoclonal antibody (M01), clone 1G4-1G5 Western Blot analysis of SAE1 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SAE1 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SAE1 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to SAE1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — SAE1
Entrez GeneID
10055GeneBank Accession#
BC000344Protein Accession#
AAH00344Gene Name
SAE1
Gene Alias
AOS1, FLJ3091, HSPC140, SUA1
Gene Description
SUMO1 activating enzyme subunit 1
Gene Ontology
HyperlinkOther Designations
SUMO-1 activating enzyme E1 N subunit|SUMO-1 activating enzyme subunit 1|activator of SUMO1|sentrin/SUMO-activating protein AOS1|ubiquitin-like protein SUMO-1 activating enzyme
-
Interactome
-
Pathway
-
Publication Reference
-
Clinical characteristics of anti-SAE antibodies in Chinese patients with dermatomyositis in comparison with different patient cohorts.
Ge Y, Lu X, Shu X, Peng Q, Wang G.
Scientific Reports 2017 Mar; 7(1):188.
Application:WB, Human, Serum from Chinese patients with polymyositis/dermatomyositis, K-562 cells.
-
Autoantibodies to small ubiquitin-like modifier activating enzymes in Japanese patients with dermatomyositis: comparison with a UK Caucasian cohort.
Fujimoto M, Matsushita T, Hamaguchi Y, Kaji K, Asano Y, Ogawa F, Yamaoka T, Fujikawa K, Tsukada T, Sato K, Echigo T, Hasegawa M, Takehara K.
Annals of the Rheumatic Diseases 2013 Jan; 72(1):151.
Application:WB, Human, Human serum, K562 cells.
-
Clinical characteristics of anti-SAE antibodies in Chinese patients with dermatomyositis in comparison with different patient cohorts.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com