Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AP1M2 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00010053-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human AP1M2 protein.
  • Immunogen:
  • AP1M2 (NP_005489, 1 a.a. ~ 423 a.a) full-length human protein.
  • Sequence:
  • MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLLSHGQVHFLWIKHSNLYLVATTSKNANASLVYSFLYKTIEVFCEYFKELEEESIRDNFVIVYELLDELMDFGFPQTTDSKILQEYITQQSNKLETGKSRVPPTVTNAVSWRSEGIKYKKNEVFIDVIESVNLLVNANGSVLLSEIVGTIKLKVFLSGMPELRLGLNDRVLFELTGRSKNKSVELEDVKFHQCVRLSRFDNDRTISFIPPDGDFELMSYRLSTQVKPLIWIESVIEKFSHSRVEIMVKAKGQFKKQSVANGVEISVPVPSDADSPRFKTSVGSAKYVPERNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEVEGRPPIGVKFEIPYFTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLRTS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of AP1M2 expression in transfected 293T cell line by AP1M2 MaxPab polyclonal antibody.

    Lane 1: AP1M2 transfected lysate(46.53 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • AP1M2
  • Gene Alias:
  • AP1-mu2,HSMU1B,MU-1B,MU1B,mu2
  • Gene Description:
  • adaptor-related protein complex 1, mu 2 subunit
  • Gene Summary:
  • This gene encodes a subunit of the heterotetrameric adaptor-related protein comlex 1 (AP-1), which belongs to the adaptor complexes medium subunits family. This protein is capable of interacting with tyrosine-based sorting signals. [provided by RefSeq
  • Other Designations:
  • AP-mu chain family member mu1B,HA1 47 kDa subunit 2,clathrin assembly protein complex 1 medium chain 2,clathrin coat assembly protein AP47 2,clathrin coat associated protein AP47 2,clathrin-associated adaptor medium chain mu2,golgi adaptor AP-1 47 kDa pro
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook