CST8 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CST8 protein.
Immunogen
CST8 (AAH69536.1, 1 a.a. ~ 90 a.a) full-length human protein.
Sequence
MQEYNKESEDKYVFLVVKTLQAQLQVTNLLEYLIDVEIARSDCRKPLSTNEICAIQENSKLKRKLSCSFLVGALPWNGEFTVMEKKCEDA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (62); Rat (65)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CST8 expression in transfected 293T cell line (H00010047-T01) by CST8 MaxPab polyclonal antibody.
Lane 1: CST8 transfected lysate(9.9 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CST8
Entrez GeneID
10047GeneBank Accession#
BC069536.1Protein Accession#
AAH69536.1Gene Name
CST8
Gene Alias
CRES
Gene Description
cystatin 8 (cystatin-related epididymal specific)
Omim ID
608683Gene Ontology
HyperlinkGene Summary
The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a protein similar to type 2 cystatins. The protein exhibits highly tissue-specific expression in the reproductive tract, suggesting implicit roles in reproduction. Alternative splicing identified in mouse is suggested in human based on EST evidence but the full-length nature of putative variants has not been determined. [provided by RefSeq
Other Designations
OTTHUMP00000030434|cystatin 8|cystatin-related epididymal spermatogenic protein|cystatin-related epididymal-specific
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com