TOM1 monoclonal antibody (M01), clone 5A3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
TOM1 monoclonal antibody (M01), clone 5A3 Western Blot analysis of TOM1 expression in K-562 ( Cat # L009V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of TOM1 expression in transfected 293T cell line by TOM1 monoclonal antibody (M01), clone 5A3.
Lane 1: TOM1 transfected lysate(53.8 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TOM1 on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TOM1 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.52 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TOM1.
Immunogen
TOM1 (NP_005479, 394 a.a. ~ 491 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GLAGALDARQQSTGAIPVTQACLMEDIEQWLSTDVGNDAEEPKGVTSEEFDKFLEERAKAADRLPNLSSPSAEGPPGPPSGPAPRKKTQEKDDDMLFA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84); Rat (88)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TOM1 monoclonal antibody (M01), clone 5A3 Western Blot analysis of TOM1 expression in K-562 ( Cat # L009V1 ).Western Blot (Transfected lysate)
Western Blot analysis of TOM1 expression in transfected 293T cell line by TOM1 monoclonal antibody (M01), clone 5A3.
Lane 1: TOM1 transfected lysate(53.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TOM1 on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TOM1 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — TOM1
Entrez GeneID
10043GeneBank Accession#
NM_005488Protein Accession#
NP_005479Gene Name
TOM1
Gene Alias
FLJ33404
Gene Description
target of myb1 (chicken)
Omim ID
604700Gene Ontology
HyperlinkGene Summary
This gene was identified as a target of the v-myb oncogene. The encoded protein shares its N-terminal domain in common with proteins associated with vesicular trafficking at the endosome. It is recruited to the endosomes by its interaction with endofin. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000028777|target of myb 1|target of myb1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com