Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HMG2L1 monoclonal antibody (M03), clone 3C12

  • Catalog # : H00010042-M03
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant HMG2L1.
  • Immunogen:
  • HMG2L1 (NP_001003681, 1 a.a. ~ 74 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MAYDDSVKKEDCFDGDHTFEDIGLAAGRSQREKKRSYKDFLREEEEIAAQVRNSSKKKLKDSELYFLGTDTHKK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010042-M03
    Western Blot detection against Immunogen (33.88 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlargeenlarge this image
  • Immunoperoxidase of monoclonal antibody to HMG2L1 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • HMGXB4
  • Gene Alias:
  • HMG2L1,HMGBCG,THC211630
  • Gene Description:
  • HMG box domain containing 4
  • Other Designations:
  • OTTHUMP00000028778,high-mobility group protein 2-like 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook