CHAF1A (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CHAF1A partial ORF ( AAH67093, 21 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
CKDRPAFPVKKLIQARLPFKRLNLVPKGKADDMSDDQGTSVQSKSPDLEASLDTLENNCHVGSDIDFRPKLVNGKGPLDNFLRNRIETSIGQSTVIIDLT
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.63
Interspecies Antigen Sequence
Mouse (58); Rat (58)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CHAF1A
Entrez GeneID
10036GeneBank Accession#
BC067093Protein Accession#
AAH67093Gene Name
CHAF1A
Gene Alias
CAF-1, CAF1, CAF1B, CAF1P150, MGC71229, P150
Gene Description
chromatin assembly factor 1, subunit A (p150)
Omim ID
601246Gene Ontology
HyperlinkGene Summary
Chromatin assembly factor I (CAF1) is a nuclear complex consisting of p50, p60 (CHAF1B; MIM 601245), and p150 (CHAF1A) subunits that assembles histone octamers onto replicating DNA in vitro (Kaufman et al., 1995 [PubMed 7600578]).[supplied by OMIM
Other Designations
chromatin assembly factor I (150 kDa)
-
Interactome
-
Disease
-
Publication Reference
-
Antiribonuclease H2 antibodies are an immune biomarker for systemic lupus erythematosus.
Nozawa K, Doe K, Uomori K, Sekigawa I, Takasaki Y, Yamaji K, Tamura N.
Autoimmunity 2017 May; 50(4):241.
Application:ELISA, Human, Serum from patients with systemic lupus erythematosus.
-
Antibody against chromatin assembly factor-1 is a novel autoantibody specifically recognized in systemic lupus erythematosus.
Doe K, Nozawa K, Hiruma K, Yamada Y, Matsuki Y, Nakano S, Ogasawara M, Nakano H, Ikeda T, Ikegami T, Fujishiro M, Kawasaki M, Ikeda K, Amano H, Morimoto S, Ogawa H, Takamori K, Sekigawa I, Takasaki Y.
Lupus 2014 Sep; 23(10):1031.
Application:ELISA, Human, Serum.
-
Antiribonuclease H2 antibodies are an immune biomarker for systemic lupus erythematosus.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com