CHAF1A monoclonal antibody (M02), clone 1C2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CHAF1A monoclonal antibody (M02), clone 1C2 Western Blot analysis of CHAF1A expression in Hela S3 NE ( Cat # L013V3 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CHAF1A is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CHAF1A.
Immunogen
CHAF1A (AAH67093, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CKDRPAFPVKKLIQARLPFKRLNLVPKGKADDMSDDQGTSVQSKSPDLEASLDTLENNCHVGSDIDFRPKLVNGKGPLDNFLRNRIETSIGQSTVIIDLT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (58); Rat (58)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CHAF1A monoclonal antibody (M02), clone 1C2 Western Blot analysis of CHAF1A expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CHAF1A is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — CHAF1A
Entrez GeneID
10036GeneBank Accession#
BC067093Protein Accession#
AAH67093Gene Name
CHAF1A
Gene Alias
CAF-1, CAF1, CAF1B, CAF1P150, MGC71229, P150
Gene Description
chromatin assembly factor 1, subunit A (p150)
Omim ID
601246Gene Ontology
HyperlinkGene Summary
Chromatin assembly factor I (CAF1) is a nuclear complex consisting of p50, p60 (CHAF1B; MIM 601245), and p150 (CHAF1A) subunits that assembles histone octamers onto replicating DNA in vitro (Kaufman et al., 1995 [PubMed 7600578]).[supplied by OMIM
Other Designations
chromatin assembly factor I (150 kDa)
-
Interactome
-
Disease
-
Publication Reference
-
Antibody against chromatin assembly factor-1 is a novel autoantibody specifically recognized in systemic lupus erythematosus.
Doe K, Nozawa K, Hiruma K, Yamada Y, Matsuki Y, Nakano S, Ogasawara M, Nakano H, Ikeda T, Ikegami T, Fujishiro M, Kawasaki M, Ikeda K, Amano H, Morimoto S, Ogawa H, Takamori K, Sekigawa I, Takasaki Y.
Lupus 2014 Sep; 23(10):1031.
Application：IF, WB, Human, Serum, HEp-2 cells.
-
Antibody against chromatin assembly factor-1 is a novel autoantibody specifically recognized in systemic lupus erythematosus.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com