PDCD6IP monoclonal antibody (M01), clone 3C4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PDCD6IP.
Immunogen
PDCD6IP (AAH20066, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Isotype
IgG2a kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PDCD6IP is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PDCD6IP on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PDCD6IP
Entrez GeneID
10015GeneBank Accession#
BC020066Protein Accession#
AAH20066Gene Name
PDCD6IP
Gene Alias
AIP1, Alix, DRIP4, HP95, MGC17003
Gene Description
programmed cell death 6 interacting protein
Omim ID
608074Gene Ontology
HyperlinkGene Summary
This gene encodes a protein thought to participate in programmed cell death. Studies using mouse cells have shown that overexpression of this protein can block apoptosis. In addition, the product of this gene binds to the product of the PDCD6 gene, a protein required for apoptosis, in a calcium-dependent manner. This gene product also binds to endophilins, proteins that regulate membrane shape during endocytosis. Overexpression of this gene product and endophilins results in cytoplasmic vacuolization, which may be partly responsible for the protection against cell death. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
ALG-2 interacting protein 1|ALG-2 interacting protein X|apoptosis-linked gene 2-interacting protein X|dopamine receptor interacting protein 4|programmed cell death 6-interacting protein
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Stability of human salivary extracellular vesicles containing dipeptidyl peptidase IV under simulated gastrointestinal tract conditions.
Yuko Ogawa, Yoshihiro Akimoto, Mamoru Ikemoto, Yoshikuni Goto, Anna Ishikawa, Sakura Ohta, Yumi Takase, Hayato Kawakami, Masafumi Tsujimoto, Ryohei Yanoshita.
Biochemistry and Biophysics Reports 2021 Jun; 27:101034.
Application:IEM, Human, Human salivary extracellular vesicles fractions.
-
Stability of human salivary extracellular vesicles containing dipeptidyl peptidase IV under simulated gastrointestinal tract conditions.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com