HDAC6 monoclonal antibody (M01), clone 1E2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HDAC6.
Immunogen
HDAC6 (NP_006035, 1128 a.a. ~ 1215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFGEDMPHPH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (75); Rat (73)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.42 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HDAC6 monoclonal antibody (M01), clone 1E2 Western Blot analysis of HDAC6 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of HDAC6 expression in transfected 293T cell line by HDAC6 monoclonal antibody (M01), clone 1E2.
Lane 1: HDAC6 transfected lysate (Predicted MW: 131.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HDAC6 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — HDAC6
Entrez GeneID
10013GeneBank Accession#
NM_006044Protein Accession#
NP_006035Gene Name
HDAC6
Gene Alias
FLJ16239, HD6, JM21
Gene Description
histone deacetylase 6
Omim ID
300272Gene Ontology
HyperlinkGene Summary
Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class II of the histone deacetylase/acuc/apha family. It contains an internal duplication of two catalytic domains which appear to function independently of each other. This protein possesses histone deacetylase activity and represses transcription. [provided by RefSeq
Other Designations
OTTHUMP00000032398
-
Interactome
-
Disease
-
Publication Reference
-
Chemoproteomics profiling of HDAC inhibitors reveals selective targeting of HDAC complexes.
Bantscheff M, Hopf C, Savitski MM, Dittmann A, Grandi P, Michon AM, Schlegl J, Abraham Y, Becher I, Bergamini G, Boesche M, Delling M, Dumpelfeld B, Eberhard D, Huthmacher C, Mathieson T, Poeckel D, Reader V, Strunk K, Sweetman G, Kruse U, Neubauer G, Ramsden NG, Drewes G.
Nature Biotechnology 2011 Mar; 29(3):255.
Application:IP, Human, K-562 cells.
-
Chemoproteomics profiling of HDAC inhibitors reveals selective targeting of HDAC complexes.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com