TANK purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
TANK MaxPab rabbit polyclonal antibody. Western Blot analysis of TANK expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of TANK expression in transfected 293T cell line (H00010010-T02) by TANK MaxPab polyclonal antibody.
Lane 1: TANK transfected lysate(13.60 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human TANK protein.
Immunogen
TANK (NP_597841.1, 1 a.a. ~ 119 a.a) full-length human protein.
Sequence
MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVDIASAESSI
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (79); Rat (78)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
TANK MaxPab rabbit polyclonal antibody. Western Blot analysis of TANK expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of TANK expression in transfected 293T cell line (H00010010-T02) by TANK MaxPab polyclonal antibody.
Lane 1: TANK transfected lysate(13.60 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — TANK
Entrez GeneID
10010GeneBank Accession#
NM_133484.1Protein Accession#
NP_597841.1Gene Name
TANK
Gene Alias
I-TRAF, TRAF2
Gene Description
TRAF family member-associated NFKB activator
Omim ID
603893Gene Ontology
HyperlinkGene Summary
The TRAF (tumor necrosis factor receptor-associated factor) family of proteins associate with and transduce signals from members of the tumor necrosis factor receptor superfamily. The protein encoded by this gene is found in the cytoplasm and can bind to TRAF1, TRAF2, or TRAF3, thereby inhibiting TRAF function by sequestering the TRAFs in a latent state in the cytoplasm. For example, the protein encoded by this gene can block TRAF2 binding to LMP1, the Epstein-Barr virus transforming protein, and inhibit LMP1-mediated NF-kappa-B activation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
TRAF family member-associated NF-KAPPA-B activator|TRAF interacting protein TANK
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com