ZBTB33 monoclonal antibody (M01), clone 2B2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ZBTB33.
Immunogen
ZBTB33 (AAH42753, 564 a.a. ~ 673 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRSSTIPAMKDDGIGYKVDTGKEPPVGTTTSTQNKPMTWEDIFIQQENDSIFKQNVTDGSTEFEFIIPESY
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86); Rat (85)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ZBTB33 expression in transfected 293T cell line by ZBTB33 monoclonal antibody (M01), clone 2B2.
Lane 1: ZBTB33 transfected lysate(74.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZBTB33 is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of ZBTB33 over-expressed 293 cell line, cotransfected with ZBTB33 Validated Chimera RNAi ( Cat # H00010009-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ZBTB33 monoclonal antibody (M01), clone 2B2 (Cat # H00010009-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to ZBTB33 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — ZBTB33
Entrez GeneID
10009GeneBank Accession#
BC042753Protein Accession#
AAH42753Gene Name
ZBTB33
Gene Alias
ZNF-kaiso, ZNF348
Gene Description
zinc finger and BTB domain containing 33
Omim ID
300329Gene Ontology
HyperlinkGene Summary
KAISO is a transcriptional regulator that binds, via its zinc fingers, to DNA sequences containing methylated CGCG or to the consensus KAISO-binding site (KBS) TCCTGCNA (Filion et al., 2006 [PubMed 16354688]).[supplied by OMIM
Other Designations
OTTHUMP00000023935|WUGSC:H_DJ525N14.1|kaiso|kaiso transcription factor
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com