Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ACOT8 (Human) Recombinant Protein (P01)

  • Catalog # : H00010005-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ACOT8 full-length ORF ( NP_005460.2, 1 a.a. - 319 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSSPQAPEDGQGCGDRGDPPGDLRSVLVTTVLNLEPLDEDLFRGRHYWVPAKRLFGGQIVGQALVAAAKSVSEDVHVHSLHCYFVRAGDPKLPVLYQVERTRTGSSFSVRSVKAVQHGKPIFICQASFQQAQPSPMQHQFSMPTVPPPEELLDCETLIDQYLRDPNLQKRYPLALNRIAAQEVPIEIKPVNPSPLSQLQRMEPKQMFWVRARGYIGEGDMKMHCCVAAYISDYAFLGTALLPHQWQHKVHFMVSLDHSMWFHAPFRADHWMLYECESPWAGGSRGLVHGRLWRQDGVLAVTCAQEGVIRVKPQVSESKL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 62.3
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010005-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • ACOT8
  • Gene Alias:
  • HNAACTE,PTE-2,PTE1,PTE2,hACTE-III,hTE
  • Gene Description:
  • acyl-CoA thioesterase 8
  • Gene Summary:
  • The protein encoded by this gene is a peroxisomal thioesterase that appears to be involved more in the oxidation of fatty acids rather than in their formation. The encoded protein can bind to the human immunodeficiency virus-1 protein Nef, and mediate Nef-induced down-regulation of CD4 in T-cells. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • HIV-Nef associated acyl-CoA thioesterase,OTTHUMP00000031675,long-chain fatty-acyl-CoA hydrolase,palmitoyl-CoA hydrolase,peroxisomal acyl-CoA thioesterase 1,peroxisomal acyl-coenzyme A thioester hydrolase 1,peroxisomal long-chain acyl-CoA thioesterase 1,th
  • RSS
  • YouTube
  • Linkedin
  • Facebook