NR2E3 MaxPab mouse polyclonal antibody (B01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human NR2E3 protein.
Immunogen
NR2E3 (NP_055064.1, 1 a.a. ~ 410 a.a) full-length human protein.
Sequence
METRPTALMSSTVAAAAPAAGAASRKESPGRWGLGEDPTGVSPSLQCRVCGDSSSGKHYGIYACNGCSGFFKRSVRRRLIYRCQVGAGMCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSTAQVHLDSMESNTESRPESLVAPPAPAGRSPRGPTPMSAARALGHHFMASLITAETCAKLEPEDADENIDVTSNDPEFPSSPYSSSSPCGLDSIHETSARLLFMAVKWAKNLPVFSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAPPEASAAGGAQGRLTLASMETRVLQETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIELLFFRKTIGNTPMEKLLCDMFKN
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of NR2E3 expression in transfected 293T cell line (H00010002-T01) by NR2E3 MaxPab polyclonal antibody.
Lane 1: NR2E3 transfected lysate(45.1 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — NR2E3
Entrez GeneID
10002GeneBank Accession#
NM_014249.2Protein Accession#
NP_055064.1Gene Name
NR2E3
Gene Alias
ESCS, MGC49976, PNR, RNR, RP37, rd7
Gene Description
nuclear receptor subfamily 2, group E, member 3
Gene Ontology
HyperlinkGene Summary
This protein is part of a large family of nuclear receptor transcription factors involved in signaling pathways. Nuclear receptors have been shown to regulate pathways involved in embryonic development, as well as in maintenance of proper cell function in adults. Members of this family are characterized by discrete domains that function in DNA and ligand binding. This gene encodes a retinal nuclear receptor that is a ligand-dependent transcription factor. Defects in this gene are a cause of enhanced S cone syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
photoreceptor-specific nuclear receptor|retina-specific nuclear receptor
-
Interactome
-
Disease
-
Publication Reference
-
In pursuit of synthetic modulators for the orphan retina-specific nuclear receptor NR2E3.
Qin Q, Knapinska A, Dobri N, Madoux F, Chase P, Hodder P, Petrukhin K.
Journal of Ocular Pharmacology and Therapeutics 2013 Apr; 29(3):298.
Application:Func, WB-Tr, Insect, Mouse, CHO, Sf9 cells.
-
In pursuit of synthetic modulators for the orphan retina-specific nuclear receptor NR2E3.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com