Product Browser

Last updated: 2017/2/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SCO2 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00009997-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human SCO2 protein.
  • Immunogen:
  • SCO2 (NP_005129.1, 1 a.a. ~ 266 a.a) full-length human protein.
  • Sequence:
  • MLLLTRSPTAWHRLSQLKPRVLPGTLGGQALHLRSWLLSRQGPAETGGQGQPQGPGLRTRLLITGLFGAGLGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVLS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SCO2 expression in transfected 293T cell line (H00009997-T02) by SCO2 MaxPab polyclonal antibody.

    Lane 1: SCO2 transfected lysate(29.26 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9997
  • Gene Name:
  • SCO2
  • Gene Alias:
  • MGC125823,MGC125825,SCO1L
  • Gene Description:
  • SCO cytochrome oxidase deficient homolog 2 (yeast)
  • Gene Summary:
  • Mammalian cytochrome c oxidase (COX) catalyzes the transfer of reducing equivalents from cytochrome c to molecular oxygen and pumps protons across the inner mitochondrial membrane. In yeast, 2 related COX assembly genes, SCO1 and SCO2 (synthesis of cytochrome c oxidase), enable subunits 1 and 2 to be incorporated into the holoprotein. This gene is the human homolog of the yeast SCO2 gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000196773,SCO (cytochrome oxidase deficient, yeast) homolog 2,cytochrome oxidase deficient homolog 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook