KCNE2 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human KCNE2 full-length ORF ( NP_751951.1, 1 a.a. - 123 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
40.9
Interspecies Antigen Sequence
Mouse (85); Rat (82)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — KCNE2
Entrez GeneID
9992GeneBank Accession#
NM_172201.1Protein Accession#
NP_751951.1Gene Name
KCNE2
Gene Alias
LQT5, LQT6, MGC138292, MIRP1
Gene Description
potassium voltage-gated channel, Isk-related family, member 2
Gene Ontology
HyperlinkGene Summary
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, isk-related subfamily. This member is a small integral membrane subunit that assembles with the KCNH2 gene product, a pore-forming protein, to alter its function. This gene is expressed in heart and muscle and the gene mutations are associated with cardiac arrhythmia. [provided by RefSeq
Other Designations
cardiac voltage-gated potassium channel accessory subunit 2|minK-related peptide-1|minimum potassium ion channel-related peptide 1|potassium channel subunit, MiRP1|potassium voltage-gated channel subfamily E member 2|voltage-gated K+ channel subunit MIRP1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com