Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KCNE2 (Human) Recombinant Protein (P01)

  • Catalog # : H00009992-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human KCNE2 full-length ORF ( NP_751951.1, 1 a.a. - 123 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 40.9
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009992-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9992
  • Gene Name:
  • KCNE2
  • Gene Alias:
  • LQT5,LQT6,MGC138292,MIRP1
  • Gene Description:
  • potassium voltage-gated channel, Isk-related family, member 2
  • Gene Summary:
  • Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, isk-related subfamily. This member is a small integral membrane subunit that assembles with the KCNH2 gene product, a pore-forming protein, to alter its function. This gene is expressed in heart and muscle and the gene mutations are associated with cardiac arrhythmia. [provided by RefSeq
  • Other Designations:
  • cardiac voltage-gated potassium channel accessory subunit 2,minK-related peptide-1,minimum potassium ion channel-related peptide 1,potassium channel subunit, MiRP1,potassium voltage-gated channel subfamily E member 2,voltage-gated K+ channel subunit MIRP1
  • RSS
  • YouTube
  • Linkedin
  • Facebook