Product Browser

Last updated: 2017/1/15
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KCNE2 MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00009992-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human KCNE2 protein.
  • Immunogen:
  • KCNE2 (NP_751951.1, 1 a.a. ~ 123 a.a) full-length human protein.
  • Sequence:
  • MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of KCNE2 expression in transfected 293T cell line (H00009992-T01) by KCNE2 MaxPab polyclonal antibody.

    Lane 1: KCNE2 transfected lysate(14.5 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9992
  • Gene Name:
  • KCNE2
  • Gene Alias:
  • LQT5,LQT6,MGC138292,MIRP1
  • Gene Description:
  • potassium voltage-gated channel, Isk-related family, member 2
  • Gene Summary:
  • Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, isk-related subfamily. This member is a small integral membrane subunit that assembles with the KCNH2 gene product, a pore-forming protein, to alter its function. This gene is expressed in heart and muscle and the gene mutations are associated with cardiac arrhythmia. [provided by RefSeq
  • Other Designations:
  • cardiac voltage-gated potassium channel accessory subunit 2,minK-related peptide-1,minimum potassium ion channel-related peptide 1,potassium channel subunit, MiRP1,potassium voltage-gated channel subfamily E member 2,voltage-gated K+ channel subunit MIRP1
  • RSS
  • YouTube
  • Linkedin
  • Facebook