KCNE2 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant KCNE2.
Immunogen
KCNE2 (NP_751951, 73 a.a. ~ 123 a.a) partial recombinant protein with GST tag.
Sequence
KSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86); Rat (82)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (31.72 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — KCNE2
Entrez GeneID
9992GeneBank Accession#
NM_172201Protein Accession#
NP_751951Gene Name
KCNE2
Gene Alias
LQT5, LQT6, MGC138292, MIRP1
Gene Description
potassium voltage-gated channel, Isk-related family, member 2
Gene Ontology
HyperlinkGene Summary
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, isk-related subfamily. This member is a small integral membrane subunit that assembles with the KCNH2 gene product, a pore-forming protein, to alter its function. This gene is expressed in heart and muscle and the gene mutations are associated with cardiac arrhythmia. [provided by RefSeq
Other Designations
cardiac voltage-gated potassium channel accessory subunit 2|minK-related peptide-1|minimum potassium ion channel-related peptide 1|potassium channel subunit, MiRP1|potassium voltage-gated channel subfamily E member 2|voltage-gated K+ channel subunit MIRP1
-
Interactome
-
Disease
-
Publication Reference
-
Differential regulation of HCN channel isoform expression in thalamic neurons of epileptic and non-epileptic rat strains.
Kanyshkova T, Meuth P, Bista P, Liu Z, Ehling P, Caputi L, Dongi M, Chetkovich DM, Pape HC, Budde T.
Neurobiology of Disease 2012 Jan; 45(1):450.
Application:WB-Ti, Rat, Rat cortex.
-
Differential regulation of HCN channel isoform expression in thalamic neurons of epileptic and non-epileptic rat strains.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com