Product Browser

Last updated: 2017/7/16
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KCNE2 polyclonal antibody (A01)

  • Catalog # : H00009992-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant KCNE2.
  • Immunogen:
  • KCNE2 (NP_751951, 73 a.a. ~ 123 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • KSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009992-A01
    Western Blot detection against Immunogen (31.72 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9992
  • Gene Name:
  • KCNE2
  • Gene Alias:
  • LQT5,LQT6,MGC138292,MIRP1
  • Gene Description:
  • potassium voltage-gated channel, Isk-related family, member 2
  • Gene Summary:
  • Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, isk-related subfamily. This member is a small integral membrane subunit that assembles with the KCNH2 gene product, a pore-forming protein, to alter its function. This gene is expressed in heart and muscle and the gene mutations are associated with cardiac arrhythmia. [provided by RefSeq
  • Other Designations:
  • cardiac voltage-gated potassium channel accessory subunit 2,minK-related peptide-1,minimum potassium ion channel-related peptide 1,potassium channel subunit, MiRP1,potassium voltage-gated channel subfamily E member 2,voltage-gated K+ channel subunit MIRP1
  • RSS
  • YouTube
  • Linkedin
  • Facebook