SLC12A6 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse polyclonal antibody raised against a partial recombinant SLC12A6.
Immunogen
SLC12A6 (NP_005126, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag.
Sequence
MPHFTVTKVEDPEEGAAASISQEPSLADIKARIQDSDEPDLSQNSITGEHSQLLDDGHKKARNAYLNNSNYEEGDEYFDKNLALFEEEMD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (78); Rat (77)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.01 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — SLC12A6
Entrez GeneID
9990GeneBank Accession#
NM_005135Protein Accession#
NP_005126Gene Name
SLC12A6
Gene Alias
ACCPN, DKFZp434D2135, KCC3, KCC3A, KCC3B
Gene Description
solute carrier family 12 (potassium/chloride transporters), member 6
Gene Ontology
HyperlinkGene Summary
This gene is a member of the K-Cl cotransporter (KCC) family. K-Cl cotransporters are integral membrane proteins that lower intracellular chloride concentrations below the electrochemical equilibrium potential. The proteins encoded by this gene are activated by cell swelling induced by hypotonic conditions. Alternate splicing results in multiple transcript variants encoding different isoforms. Mutations in this gene are associated with agenesis of the corpus callosum with peripheral neuropathy. [provided by RefSeq
Other Designations
potassium chloride cotransporter 3|potassium chloride cotransporter KCC3a-S3|solute carrier family 12, member 6
-
Interactomes
-
Diseases
-
Publication Reference
-
Cotransporter-mediated water transport underlying cerebrospinal fluid formation.
Steffensen AB, Oernbo EK, Stoica A, Gerkau NJ, Barbuskaite D, Tritsaris K, Rose CR, MacAulay N.
Nature Communications 2018 Jun; 9(1):2167.
Application:WB, Frog, Xenopus laevis oocytes.
-
Potassium-chloride cotransporter 3 interacts with vav2 to synchronize the cell volume decrease response with cell protrusion dynamics.
Salin-Cantegrel A, Shekarabi M, Rasheed S, Charron FM, Laganiere J, Gaudet R, Dion PA, Lapointe JY, Rouleau GA.
PLoS One 2013 May; 8(5):e65294.
Application:ICC, IP-WB, WB-Tr, Human, HeLa cells.
-
Loss of neuronal potassium/chloride cotransporter 3 (KCC3) is responsible for the degenerative phenotype in a conditional mouse model of hereditary motor and sensory neuropathy associated with agenesis of the corpus callosum.
Shekarabi M, Moldrich RX, Rasheed S, Salin-Cantegrel A, Laganière J, Rochefort D, Hince P, Huot K, Gaudet R, Kurniawan N, Sotocinal SG, Ritchie J, Dion PA, Mogil JS, Richards LJ, Rouleau GA.
Journal of Neuroscience 2012 Mar; 32(11):3865.
Application:IF, IHC, WB-Ti, Mouse, Mouse brain, kidney.
-
Transit defect of the potassium-chloride co-transporter 3 is a major pathogenic mechanism in hereditary motor and sensory neuropathy with agenesis of the corpus callosum.
Salin-Cantegrel A, Riviere JB, Shekarabi M, Rasheed S, Dacal S, Laganiere J, Gaudet R, Rochefort D, Lesca G, Gaspar C, Dion PA, Lapointe JY, Rouleau GA.
J Biol Chem 2011 May; 286:28456.
Application:IF, WB-Tr, WB-Ti, Human, HeLa, PC12 cells, Brain.
-
HMSN/ACC truncation mutations disrupt brain-type creatine kinase-dependant activation of K+/Cl- cotransporter 3.
Salin-Cantegrel A, Shekarabi M, Holbert S, Dion P, Rochefort D, Laganiere J, Dacal S, Hince P, Karemera L, Gaspar C, Lapointe JY, Rouleau GA.
Human Molecular Genetics 2008 Jun; 17(17):2703.
Application:IF, WB-Tr, Frog, Human, Mouse, HeLa cells, Mouse brain, Xenopus laevis oocyte.
-
Cotransporter-mediated water transport underlying cerebrospinal fluid formation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com