DMTF1 monoclonal antibody (M03), clone 5C6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
DMTF1 monoclonal antibody (M03), clone 5C6 Western Blot analysis of DMTF1 expression in Hela S3 NE ( Cat # L013V3 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to DMTF1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1 ug/ml]
Immunofluorescence
Immunofluorescence of monoclonal antibody to DMTF1 on HeLa cell. [antibody concentration 30 ug/ml]
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DMTF1.
Immunogen
DMTF1 (NP_066968, 661 a.a. ~ 760 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KQEESPSDLASAYVTEGLESPTIEEQVDQTIDDETILIVPSPHGFIQASDVIDTESVLPLTTLTDPILQHHQEESNIIGSSLGSPVSEDSKDVEDLVNCH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
DMTF1 monoclonal antibody (M03), clone 5C6 Western Blot analysis of DMTF1 expression in Hela S3 NE ( Cat # L013V3 ).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to DMTF1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1 ug/ml]ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to DMTF1 on HeLa cell. [antibody concentration 30 ug/ml] -
Gene Info — DMTF1
Entrez GeneID
9988GeneBank Accession#
NM_021145Protein Accession#
NP_066968Gene Name
DMTF1
Gene Alias
DMP1, DMTF, FLJ25188, FLJ41265, FLJ76054, hDMP1
Gene Description
cyclin D binding myb-like transcription factor 1
Omim ID
608491Gene Ontology
HyperlinkGene Summary
This gene encodes a transcription factor that contains a cyclin D-binding domain, three central Myb-like repeats, and two flanking acidic transactivation domains at the N- and C-termini. The encoded protein is induced by the oncogenic Ras signaling pathway and functions as a tumor suppressor by activating the transcription of ARF and thus the ARF-p53 pathway to arrest cell growth or induce apoptosis. It also activates the transcription of aminopeptidase N and may play a role in hematopoietic cell differentiation. The transcriptional activity of this protein is regulated by binding of D-cyclins. This gene is hemizygously deleted in approximately 40% of human non-small-cell lung cancer and is a potential prognostic and gene-therapy target for non-small-cell lung cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
cyclin D-binding Myb-like protein 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com