REC8 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human REC8 partial ORF ( AAH04159.1, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MFYYPNVLQRHTGCFATIWLAATRGSRLVKREYLRVNVVKTCEEILNYVLVRVQPPQPGLPRPRFSLYLSAQLQIGVIRVYSQQCQYLVEDIQHILERLHRAQLQIRIDM
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.73
Interspecies Antigen Sequence
Mouse (70); Rat (70)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — REC8
Entrez GeneID
9985GeneBank Accession#
BC004159Protein Accession#
AAH04159.1Gene Name
REC8
Gene Alias
HR21spB, MGC950, REC8L1, Rec8p
Gene Description
REC8 homolog (yeast)
Omim ID
608193Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the kleisin family of SMC (structural maintenance of chromosome) protein partners. The protein localizes to the axial elements of chromosomes during meiosis in both oocytes and spermatocytes. In the mouse, the homologous protein is a key component of the meiotic cohesion complex, which regulates sister chromatid cohesion and recombination between homologous chromosomes. Multiple alternatively spliced variants, encoding the same protein, have been found for this gene. [provided by RefSeq
Other Designations
REC8 homolog|REC8-like 1|cohesion rec8p|human homolog of rad21, S. pombe|meiotic recombination and sister chromatid cohesion phosphoprotein of the rad21p family|meiotic recombination protein REC8-like 1|recombination and sister chromatid cohesion protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com