RBX1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human RBX1 full-length ORF ( AAH01466, 1 a.a. - 108 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.62
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — RBX1
Entrez GeneID
9978GeneBank Accession#
BC001466Protein Accession#
AAH01466Gene Name
RBX1
Gene Alias
BA554C12.1, MGC13357, MGC1481, RNF75, ROC1
Gene Description
ring-box 1
Omim ID
603814Gene Ontology
HyperlinkGene Summary
This gene encodes an evolutionarily conserved protein that interacts with cullins. The protein plays a unique role in the ubiquitination reaction by heterodimerizing with cullin-1 to catalyze ubiquitin polymerization. It also may be involved in the regulation of protein turn-over. [provided by RefSeq
Other Designations
OTTHUMP00000028983|RING box protein 1|RING finger protein|ZYP protein|regulator of cullins 1
-
Interactome
-
Pathway
-
Publication Reference
-
Calmodulin protects Aurora B on the midbody to regulate the fidelity of cytokinesis.
Mallampalli RK, Glasser JR, Coon TA, Chen BB.
Cell Cycle 2013 Feb; 12(4):663.
Application：Func, Mouse, MLE cells.
-
Calmodulin protects Aurora B on the midbody to regulate the fidelity of cytokinesis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com