Product Browser

Last updated: 2017/9/17
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RBX1 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00009978-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human RBX1 protein.
  • Immunogen:
  • RBX1 (AAH01466, 1 a.a. ~ 108 a.a) full-length human protein.
  • Sequence:
  • MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of RBX1 expression in transfected 293T cell line (H00009978-T01) by RBX1 MaxPab polyclonal antibody.

    Lane 1: RBX1 transfected lysate(11.99 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9978
  • Gene Name:
  • RBX1
  • Gene Alias:
  • BA554C12.1,MGC13357,MGC1481,RNF75,ROC1
  • Gene Description:
  • ring-box 1
  • Gene Summary:
  • This gene encodes an evolutionarily conserved protein that interacts with cullins. The protein plays a unique role in the ubiquitination reaction by heterodimerizing with cullin-1 to catalyze ubiquitin polymerization. It also may be involved in the regulation of protein turn-over. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000028983,RING box protein 1,RING finger protein,ZYP protein,regulator of cullins 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook