Product Browser

Last updated: 2016/11/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RBX1 polyclonal antibody (A01)

  • Catalog # : H00009978-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant RBX1.
  • Immunogen:
  • RBX1 (AAH01466, 1 a.a. ~ 108 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9978
  • Gene Name:
  • RBX1
  • Gene Alias:
  • BA554C12.1,MGC13357,MGC1481,RNF75,ROC1
  • Gene Description:
  • ring-box 1
  • Gene Summary:
  • This gene encodes an evolutionarily conserved protein that interacts with cullins. The protein plays a unique role in the ubiquitination reaction by heterodimerizing with cullin-1 to catalyze ubiquitin polymerization. It also may be involved in the regulation of protein turn-over. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000028983,RING box protein 1,RING finger protein,ZYP protein,regulator of cullins 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook