CCS monoclonal antibody (M03), clone 1E2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CCS expression in transfected 293T cell line by CCS monoclonal antibody (M03), clone 1E2.
Lane 1: CCS transfected lysate (Predicted MW: 29 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CCS on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1.5 ug/ml]
Immunoprecipitation
Immunoprecipitation of CCS transfected lysate using anti-CCS monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CCS monoclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CCS is 0.1 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to CCS on HeLa cell . [antibody concentration 40 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CCS.
Immunogen
CCS (NP_005116, 175 a.a. ~ 274 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CCS expression in transfected 293T cell line by CCS monoclonal antibody (M03), clone 1E2.
Lane 1: CCS transfected lysate (Predicted MW: 29 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CCS on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1.5 ug/ml]Immunoprecipitation
Immunoprecipitation of CCS transfected lysate using anti-CCS monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CCS monoclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CCS is 0.1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CCS on HeLa cell . [antibody concentration 40 ug/ml] -
Gene Info — CCS
Entrez GeneID
9973GeneBank Accession#
NM_005125Protein Accession#
NP_005116Gene Name
CCS
Gene Alias
MGC138260
Gene Description
copper chaperone for superoxide dismutase
Omim ID
603864Gene Ontology
HyperlinkGene Summary
Copper chaperone for superoxide dismutase specifically delivers Cu to copper/zinc superoxide dismutase and may activate copper/zinc superoxide dismutase through direct insertion of the Cu cofactor. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Impaired Copper and Iron Metabolism in Blood Cells and Muscles of Patients Affected by Copper Deficiency Myeloneuropathy.
Spinazzi M, Sghirlanzoni A, Salviati L, Angelini C.
Neuropathology and Applied Neurobiology 2014 Dec; 40(7):888.
Application：WB-Ti, Human, Muscles.
-
Impaired Copper and Iron Metabolism in Blood Cells and Muscles of Patients Affected by Copper Deficiency Myeloneuropathy.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com