NR1H4 monoclonal antibody (M02), clone 1B10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NR1H4.
Immunogen
NR1H4 (NP_005114, 363 a.a. ~ 472 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (91)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NR1H4 monoclonal antibody (M02), clone 1B10 Western Blot analysis of NR1H4 expression in HepG2 ( Cat # L019V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NR1H4 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to NR1H4 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — NR1H4
Entrez GeneID
9971GeneBank Accession#
NM_005123Protein Accession#
NP_005114Gene Name
NR1H4
Gene Alias
BAR, FXR, HRR-1, HRR1, MGC163445, RIP14
Gene Description
nuclear receptor subfamily 1, group H, member 4
Omim ID
603826Gene Ontology
HyperlinkGene Summary
group H
Other Designations
farnesoid X receptor
-
Interactome
-
Disease
-
Publication Reference
-
Binding of hepatitis B virus to its cellular receptor alters the expression profile of genes of the bile acid metabolism.
Oehler N, Volz T, Bhadra OD, Kah J, Allweiss L, Giersch K, Bierwolf J, Riecken K, Pollok JM, Lohse AW, Fehse B, Petersen J, Urban S, Lutgehetmann M, Heeren J, Dandri M.
Hepatology 2014 Nov; 60(5):1483.
Application:IF, Mouse, Liver.
-
Bile salt export pump is dysregulated with altered farnesoid X receptor isoform expression in patients with hepatocellular carcinoma.
Chen Y, Song X, Valanejad L, Vasilenko A, More V, Qiu X, Chen W, Lai Y, Slitt A, Stoner M, Yan B, Deng R.
Hepatology 2013 Apr; 57(4):1530.
Application:WB-Ce, WB-Ti, WB-Tr, Human, Mouse, Huh7, HepG2 cells, Liver.
-
Binding of hepatitis B virus to its cellular receptor alters the expression profile of genes of the bile acid metabolism.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com