Product Browser

Last updated: 2017/9/17
  • Related Product Showcase
  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MED12 polyclonal antibody (A01)

  • Catalog # : H00009968-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant MED12.
  • Immunogen:
  • MED12 (NP_005111, 1829 a.a. ~ 1941 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • QPATKTEDYGMGPGRSGPYGVTVPPDLLHHPNPGSITHLNYRQGSIGLYTQNQPLPAGGPRVDPYRPVRLPMQKLPTRPTYPGVLPTTMTGVMGLEPSSYKTSVYRQQQPAVP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009968-A01
    Western Blot detection against Immunogen (38.54 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9968
  • Gene Name:
  • MED12
  • Gene Alias:
  • CAGH45,FGS1,HOPA,KIAA0192,OKS,OPA1,TNRC11,TRAP230
  • Gene Description:
  • mediator complex subunit 12
  • Gene Summary:
  • The initiation of transcription is controlled in part by a large protein assembly known as the preinitiation complex. A component of this preinitiation complex is a 1.2 MDa protein aggregate called Mediator. This Mediator component binds with a CDK8 subcomplex which contains the protein encoded by this gene, mediator complex subunit 12 (MED12), along with MED13, CDK8 kinase, and cyclin C. The CDK8 subcomplex modulates Mediator-polymerase II interactions and thereby regulates transcription initiation and reinitation rates. The MED12 protein is essential for activating CDK8 kinase. Defects in this gene cause X-linked Opitz-Kaveggia syndrome, also known as FG syndrome, and Lujan-Fryns syndrome. [provided by RefSeq
  • Other Designations:
  • FG syndrome 1,OPA-containing protein,OTTHUMP00000023491,mediator of RNA polymerase II transcription, subunit 12 homolog,thyroid hormone receptor-associated protein, 230 kDa subunit,trinucleotide repeat containing 11 (THR-associated protein, 230 kDa subuni
  • RSS
  • YouTube
  • Linkedin
  • Facebook