FGF19 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human FGF19 full-length ORF ( AAH17664, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
49.5
Interspecies Antigen Sequence
Mouse (50); Rat (52)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — FGF19
Entrez GeneID
9965GeneBank Accession#
BC017664Protein Accession#
AAH17664Gene Name
FGF19
Gene Alias
-
Gene Description
fibroblast growth factor 19
Omim ID
603891Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth and invasion. This growth factor is a high affinity, heparin dependent ligand for FGFR4. Expression of this gene was detected only in fetal but not adult brain tissue. Synergistic interaction of the chick homolog and Wnt-8c has been shown to be required for initiation of inner ear development. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Publication Reference
-
FGF19 Protects Colonic Epithelial Cells against Hydrogen Peroxide.
Uchiyama K, Naito Y, Takagi T, Mizushima K, Hayashi N, Handa O, Ishikawa T, Yagi N, Kokura S, Yoshikawa T.
Digestion 2011 Jan; 83(3):180.
Application：Func, Mouse, Young adult mouse colonic epithelial (YAMC) cells.
-
FGF19 Protects Colonic Epithelial Cells against Hydrogen Peroxide.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com