GOLGA5 monoclonal antibody (M01), clone 6B3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
GOLGA5 monoclonal antibody (M01), clone 6B3 Western Blot analysis of GOLGA5 expression in K-562 ( Cat # L009V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of GOLGA5 expression in transfected 293T cell line by GOLGA5 monoclonal antibody (M01), clone 6B3.
Lane 1: GOLGA5 transfected lysate(83 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GOLGA5 is approximately 0.1ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of GOLGA5 over-expressed 293 cell line, cotransfected with GOLGA5 Validated Chimera RNAi ( Cat # H00009950-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with GOLGA5 monoclonal antibody (M01), clone 6B3 (Cat # H00009950-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (36.52 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GOLGA5.
Immunogen
GOLGA5 (NP_005104, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SWFVDLAGKAEDLLNRVDQGAATALSRKDNASNIYSKNTDYTELHQQNTDLIYQTGPKSTYISSAADNIRNQKATILAGTANVKVGSRTPVEASHPVE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (83); Rat (84)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GOLGA5 monoclonal antibody (M01), clone 6B3 Western Blot analysis of GOLGA5 expression in K-562 ( Cat # L009V1 ).Western Blot (Transfected lysate)
Western Blot analysis of GOLGA5 expression in transfected 293T cell line by GOLGA5 monoclonal antibody (M01), clone 6B3.
Lane 1: GOLGA5 transfected lysate(83 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GOLGA5 is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of GOLGA5 over-expressed 293 cell line, cotransfected with GOLGA5 Validated Chimera RNAi ( Cat # H00009950-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with GOLGA5 monoclonal antibody (M01), clone 6B3 (Cat # H00009950-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — GOLGA5
Entrez GeneID
9950GeneBank Accession#
NM_005113Protein Accession#
NP_005104Gene Name
GOLGA5
Gene Alias
GOLIM5, RFG5, ret-II
Gene Description
golgi autoantigen, golgin subfamily a, 5
Gene Ontology
HyperlinkGene Summary
The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. This gene encodes a member of the golgin family of proteins, whose members localize to the Golgi. This protein is a coiled-coil membrane protein that has been postulated to play a role in vesicle tethering and docking. Translocations involving this gene and the ret proto-oncogene have been found in tumor tissues; the chimeric sequences have been designated RET-II and PTC5. [provided by RefSeq
Other Designations
Golgi autoantigen, golgin subfamily a, 5|cell proliferation-inducing gene 31|golgi integral membrane protein 5|golgin-84|ret-fused gene 5
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com