Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RBM8A (Human) Recombinant Protein (P02)

  • Catalog # : H00009939-P02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RBM8A full-length ORF ( NP_005096.1, 1 a.a. - 174 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 46.3
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009939-P02
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9939
  • Gene Name:
  • RBM8A
  • Gene Alias:
  • BOV-1A,BOV-1B,BOV-1C,MDS014,RBM8,RBM8B,Y14,ZNRP,ZRNP1
  • Gene Description:
  • RNA binding motif protein 8A
  • Gene Summary:
  • This gene encodes a protein with a conserved RNA-binding motif. The protein is found predominantly in the nucleus, although it is also present in the cytoplasm. It is preferentially associated with mRNAs produced by splicing, including both nuclear mRNAs and newly exported cytoplasmic mRNAs. It is thought that the protein remains associated with spliced mRNAs as a tag to indicate where introns had been present, thus coupling pre- and post-mRNA splicing events. Previously, it was thought that two genes encode this protein, RBM8A and RBM8B; it is now thought that the RBM8B locus is a pseudogene. Two alternative start codons result in two forms of the protein, and this gene also uses multiple polyadenylation sites. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000015573,RNA binding motif protein 8B,binder of OVCA1-1,ribonucleoprotein RBM8
  • RSS
  • YouTube
  • Linkedin
  • Facebook