HELZ monoclonal antibody (M02), clone 5B2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HELZ.
Immunogen
HELZ (NP_055692, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEDRRAEKSCEQACESLKRQDYEMALKHCTEALLSLGQYSMADFTGPCPLEIERIKIESLLYRIASFLQLKNYVQADEDCRHVLGEGLAKGEDAFRAVLC
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (89)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HELZ monoclonal antibody (M02), clone 5B2 Western Blot analysis of HELZ expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HELZ on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HELZ is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to HELZ on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — HELZ
Entrez GeneID
9931GeneBank Accession#
NM_014877Protein Accession#
NP_055692Gene Name
HELZ
Gene Alias
DHRC, DKFZp586G1924, DRHC, HUMORF5, KIAA0054, MGC163454
Gene Description
helicase with zinc finger
Omim ID
606699Gene Ontology
HyperlinkGene Summary
HELZ is a member of the superfamily I class of RNA helicases. RNA helicases alter the conformation of RNA by unwinding double-stranded regions, thereby altering the biologic activity of the RNA molecule and regulating access to other proteins (Wagner et al., 1999 [PubMed 10471385]).[supplied by OMIM
Other Designations
down-regulated in human cancers|helicase with zinc finger domain
-
Interactome
-
Publication Reference
-
The Putative RNA Helicase HELZ Promotes Cell Proliferation, Translation Initiation and Ribosomal Protein S6 Phosphorylation.
Hasgall PA, Hoogewijs D, Faza MB, Panse VG, Wenger RH, Camenisch G.
PLoS One 2011 Jul; 6(7):e22107.
Application:IF, WB-Ce, WB-Tr, Human, HEK293, MCF-7, HeLa cells.
-
The Putative RNA Helicase HELZ Promotes Cell Proliferation, Translation Initiation and Ribosomal Protein S6 Phosphorylation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com