Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HELZ polyclonal antibody (A01)

  • Catalog # : H00009931-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant HELZ.
  • Immunogen:
  • HELZ (NP_055692, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MEDRRAEKSCEQACESLKRQDYEMALKHCTEALLSLGQYSMADFTGPCPLEIERIKIESLLYRIASFLQLKNYVQADEDCRHVLGEGLAKGEDAFRAVLC
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009931-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9931
  • Gene Name:
  • HELZ
  • Gene Alias:
  • DHRC,DKFZp586G1924,DRHC,HUMORF5,KIAA0054,MGC163454
  • Gene Description:
  • helicase with zinc finger
  • Gene Summary:
  • HELZ is a member of the superfamily I class of RNA helicases. RNA helicases alter the conformation of RNA by unwinding double-stranded regions, thereby altering the biologic activity of the RNA molecule and regulating access to other proteins (Wagner et al., 1999 [PubMed 10471385]).[supplied by OMIM
  • Other Designations:
  • down-regulated in human cancers,helicase with zinc finger domain
  • RSS
  • YouTube
  • Linkedin
  • Facebook