Product Browser
 
  • Related Product Showcase
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

MFN2 monoclonal antibody (M03), clone 4H8   

  • Catalog # : H00009927-M03
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 100 ug
  • USD $ 319
  • Stock Image
  • order now, ship next day
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant MFN2.
  • Immunogen:
  • MFN2 (NP_055689, 661 a.a. ~ 757 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHLCQQVDVTRENLEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR
  • Host:
  • Mouse
  • Reactivity:
  • Human, Rat
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009927-M03
    Western Blot detection against Immunogen (36.41 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.2
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • MFN2 monoclonal antibody (M03), clone 4H8 Western Blot analysis of MFN2 expression in HeLa ( Cat # L013V1 ).
  • Protocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • MFN2 monoclonal antibody (M03), clone 4H8. Western Blot analysis of MFN2 expression in PC-12 ( Cat # L012V1 ).
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of MFN2 expression in transfected 293T cell line by MFN2 monoclonal antibody (M03), clone 4H8.

    Lane 1: MFN2 transfected lysate(86.4 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)enlargeenlarge this image
  • Immunoperoxidase of monoclonal antibody to MFN2 on formalin-fixed paraffin-embedded human heart. [antibody concentration 5 ug/ml]
  • Protocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged MFN2 is approximately 1ng/ml as a capture antibody.
  • Protocol Download
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • Western blot analysis of MFN2 over-expressed 293 cell line, cotransfected with MFN2 Validated Chimera RNAi ( Cat # H00009927-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MFN2 monoclonal antibody (M03), clone 4H8 (Cat # H00009927-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • Protocol Download
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9927
  • Gene Name:
  • MFN2
  • Gene Alias:
  • CMT2A,CMT2A2,CPRP1,HSG,KIAA0214,MARF
  • Gene Description:
  • mitofusin 2
  • Gene Summary:
  • This gene encodes a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. This protein is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke. Two transcript variants encoding the same protein have been identified. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000002509,hyperplasia suppressor,mitochondrial assembly regulatory factor,mitofusin-2,transmembrane GTPase MFN2
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!