Product Browser

Last updated: 2016/11/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

USP52 monoclonal antibody (M01), clone 6A7

  • Catalog # : H00009924-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant USP52.
  • Immunogen:
  • USP52 (NP_055686, 1099 a.a. ~ 1198 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • TVYLFHMPRKRMISLRFLAWYFLDLKIQGETHDSIEDARTALQLYRKYLELSKNGTEPESFHKVLKGLYEKGRKMDWKVPEPEGQTSPKNAAVFSSVLAL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009924-M01
    Western Blot detection against Immunogen (36.74 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged USP52 is approximately 30ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9924
  • Gene Name:
  • PAN2
  • Gene Alias:
  • FLJ39360,KIAA0710,USP52,hPAN2
  • Gene Description:
  • PAN2 poly(A) specific ribonuclease subunit homolog (S. cerevisiae)
  • Other Designations:
  • PABP-dependent poly(A) nuclease 2,PAN2 homolog, PABP1 dependent poly A specific ribonuclease subunit,PAN2 polyA specific ribonuclease subunit homolog,ubiquitin specific peptidase 52,ubiquitin specific protease 52
  • RSS
  • YouTube
  • Linkedin
  • Facebook