Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SNAP91 polyclonal antibody (A01)

  • Catalog # : H00009892-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SNAP91.
  • Immunogen:
  • SNAP91 (NP_055656, 156 a.a. ~ 255 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MRTMAPEKLLKSMPILQGQIDALLEFDVHPNELTNGVINAAFMLLFKDLIKLFACYNDGVINLLEKFFEMKKGQCKDALEIYKRFLTRMTRVSEFLKVAE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009892-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SNAP91 polyclonal antibody (A01), Lot # 060707JCS1. Western Blot analysis of SNAP91 expression in Daoy. (Isoform : 63.128 kDa)
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9892
  • Gene Name:
  • SNAP91
  • Gene Alias:
  • AP180,CALM,DKFZp781O0519,KIAA0656
  • Gene Description:
  • synaptosomal-associated protein, 91kDa homolog (mouse)
  • Other Designations:
  • assembly protein, 180kDa,clathrin coat assembly protein AP180,synaptosomal-associated protein, 91kDa homolog
  • RSS
  • YouTube
  • Linkedin
  • Facebook