Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NUAK1 polyclonal antibody (A01)

  • Catalog # : H00009891-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant NUAK1.
  • Immunogen:
  • NUAK1 (NP_055655, 371 a.a. ~ 470 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • SKKENDFAQSGQDAVPESPSKLSSKRPKGILKKRSNSEHRSHSTGFIEGVVGPALPSTFKMEQDLCRTGVLLPSSPEAEVPGKLSPKQSATMPKKGILKK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9891
  • Gene Name:
  • NUAK1
  • Gene Alias:
  • ARK5,KIAA0537
  • Gene Description:
  • NUAK family, SNF1-like kinase, 1
  • Other Designations:
  • AMP-activated protein kinase family member 5,AMPK-related protein kinase 5
  • RSS
  • YouTube
  • Linkedin
  • Facebook