TLK1 monoclonal antibody (M01), clone 4B3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
TLK1 monoclonal antibody (M01), clone 4B3 Western Blot analysis of TLK1 expression in Hela S3 NE ( Cat # L013V3 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TLK1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TLK1 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (38.83 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TLK1.
Immunogen
TLK1 (AAH32657, 111 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TPEKKQSESSRGRKRKAENQNESSQGKSIGGRGHKISDYFEYQGGNGSSPVRGIPPAIRSPQNSHSHSTPSSSVRPNSPSPTALAFGDHPIVQPKQLSFKIIQTDLTMLKLAALESNKIQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98)
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.83 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TLK1 monoclonal antibody (M01), clone 4B3 Western Blot analysis of TLK1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TLK1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TLK1 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — TLK1
Entrez GeneID
9874GeneBank Accession#
BC032657Protein Accession#
AAH32657Gene Name
TLK1
Gene Alias
KIAA0137, PKU-beta
Gene Description
tousled-like kinase 1
Omim ID
608438Gene Ontology
HyperlinkGene Summary
The Tousled-like kinases, first described in Arabidopsis, are nuclear serine/threonine kinases that are potentially involved in the regulation of chromatin assembly.[supplied by OMIM
Other Designations
SNARE protein kinase SNAK|serine threonine protein kinase
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com