SEC24D monoclonal antibody (M04), clone 1A8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SEC24D.
Immunogen
SEC24D (NP_055637, 935 a.a. ~ 1032 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SPPELIQGIFNVPSFAHINTDMTLLPEVGNPYSQQLRMIMGIIQQKRPYSMKLTIVKQREQPEMVFRQFLVEDKGLYGGSSYVDFLCCVHKEICQLLN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.41 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SEC24D monoclonal antibody (M04), clone 1A8 Western Blot analysis of SEC24D expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — SEC24D
Entrez GeneID
9871GeneBank Accession#
NM_014822Protein Accession#
NP_055637Gene Name
SEC24D
Gene Alias
FLJ43974, KIAA0755
Gene Description
SEC24 family, member D (S. cerevisiae)
Omim ID
607186Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the SEC24 subfamily of the SEC23/SEC24 family, which is involved in vesicle trafficking. The encoded protein has similarity to yeast Sec24p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. This gene product is implicated in the shaping of the vesicle, and also in cargo selection and concentration. [provided by RefSeq
Other Designations
SEC24 related gene family, member D|Sec24-related protein D|protein transport protein Sec24D
-
Interactome
-
Disease
-
Publication Reference
-
Hsp70 promotes epithelial sodium channel functional expression by increasing its association with coat complex II and its exit from endoplasmic reticulum.
Chanoux RA, Robay A, Shubin CB, Kebler C, Suaud L, Rubenstein RC.
The Journal of Biological Chemistry 2012 Jun; 287(23):19255.
Application:IP, WB, Dog, MDCK cells.
-
Role of Rab1b in COPII dynamics and function.
Slavin I, Garcia IA, Monetta P, Martinez H, Romero N, Alvarez C.
European Journal of Cell Biology 2011 Apr; 90(4):301.
Application:WB-Tr, Human, HEK293Tcells.
-
New class of microRNA targets containing simultaneous 5'-UTR and 3'-UTR interaction sites.
Lee I, Ajay SS, Yook JI, Kim HS, Hong SH, Kim NH, Dhanasekaran SM, Chinnaiyan AM, Athey BD.
Genome Research 2009 Jul; 19(7):1175.
Application:WB-Ce, Human, HeLa cells.
-
Hsp70 promotes epithelial sodium channel functional expression by increasing its association with coat complex II and its exit from endoplasmic reticulum.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com