THRAP4 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human THRAP4 partial ORF ( AAH11375, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MKVVNLKQAILQAWKERWSDYQWAINMKKFFPKGATWDILNLADALLEQAMIGPSPNPLILSYLKYAISSQMVSYSSVLTAISKFDDFSRDLCVQALLDIMDMFCDRLSC
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.84
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — MED24
Entrez GeneID
9862GeneBank Accession#
BC011375Protein Accession#
AAH11375Gene Name
MED24
Gene Alias
ARC100, CRSP100, CRSP4, DRIP100, KIAA0130, MGC8748, THRAP4, TRAP100
Gene Description
mediator complex subunit 24
Omim ID
607000Gene Ontology
HyperlinkGene Summary
This gene encodes a component of the mediator complex (also known as TRAP, SMCC, DRIP, or ARC), a transcriptional coactivator complex thought to be required for the expression of almost all genes. The mediator complex is recruited by transcriptional activators or nuclear receptors to induce gene expression, possibly by interacting with RNA polymerase II and promoting the formation of a transcriptional pre-initiation complex. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000164458|OTTHUMP00000164460|activator-recruited cofactor 100 kDa component|cofactor required for Sp1 transcriptional activation, subunit 4, 100kDa|mediator of RNA polymerase II transcription, subunit 24 homolog|thyroid hormone receptor associate
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com