EPM2AIP1 monoclonal antibody (M01), clone 3H7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
EPM2AIP1 monoclonal antibody (M01), clone 3H7. Western Blot analysis of EPM2AIP1 expression in NIH/3T3(Cat # L018V1 ).
Western Blot (Cell lysate)
EPM2AIP1 monoclonal antibody (M01), clone 3H7. Western Blot analysis of EPM2AIP1 expression in Raw 264.7(Cat # L024V1 ).
Western Blot (Cell lysate)
EPM2AIP1 monoclonal antibody (M01), clone 3H7. Western Blot analysis of EPM2AIP1 expression in PC-12(Cat # L012V1 ).
Western Blot (Cell lysate)
EPM2AIP1 monoclonal antibody (M01), clone 3H7 Western Blot analysis of EPM2AIP1 expression in HeLa ( Cat # L013V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EPM2AIP1 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EPM2AIP1.
Immunogen
EPM2AIP1 (NP_055620, 508 a.a. ~ 606 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TKLQANTNLWNEYRIKDLGQFYAGLSAESYPIIKGVACKVASLFDSNQICEKAFSYLTRNQHTLSQPLTDEHLQALFRVATTEMEPGWDDLVRERNESN
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (89); Rat (88)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
EPM2AIP1 monoclonal antibody (M01), clone 3H7. Western Blot analysis of EPM2AIP1 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
EPM2AIP1 monoclonal antibody (M01), clone 3H7. Western Blot analysis of EPM2AIP1 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
EPM2AIP1 monoclonal antibody (M01), clone 3H7. Western Blot analysis of EPM2AIP1 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
EPM2AIP1 monoclonal antibody (M01), clone 3H7 Western Blot analysis of EPM2AIP1 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EPM2AIP1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — EPM2AIP1
Entrez GeneID
9852GeneBank Accession#
NM_014805Protein Accession#
NP_055620Gene Name
EPM2AIP1
Gene Alias
FLJ11207, KIAA0766
Gene Description
EPM2A (laforin) interacting protein 1
Omim ID
607911Gene Ontology
HyperlinkGene Summary
The EPM2A gene, which encodes laforin, is mutated in an autosomal recessive form of adolescent progressive myoclonus epilepsy. The protein encoded by this gene binds to laforin, but its function is not known. This gene is intronless. [provided by RefSeq
Other Designations
EPM2A interacting protein 1
-
Interactome
-
Disease
-
Publication Reference
-
Deficiency of a Glycogen Synthase-associated Protein, Epm2aip1, Causes Decreased Glycogen Synthesis and Hepatic Insulin Resistance.
Turnbull J, Tiberia E, Pereira S, Zhao X, Pencea N, Wheeler AL, Yu WQ, Ivovic A, Naranian T, Israelian N, Draginov A, Piliguian M, Frankland PW, Wang P, Ackerley CA, Giacca A, Minassian BA.
The Journal of Biological Chemistry 2013 Nov; 288(48):34627.
Application：IP-WB, Mouse, Brain, Liver.
-
Deficiency of a Glycogen Synthase-associated Protein, Epm2aip1, Causes Decreased Glycogen Synthesis and Hepatic Insulin Resistance.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com