Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ARHGEF11 (Human) Recombinant Protein (Q01)

  • Catalog # : H00009826-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ARHGEF11 partial ORF ( AAH57394, 651 a.a. - 750 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • RSESLKGREEMKRSRKAENVPRSRSDVDMDAAAEATRLHQSASSSTSSLSTRSLENPTPPFTPKMGRRSIESPSLGFCTDTLLPHLLEDDLGQLSDLEPE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009826-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9826
  • Gene Name:
  • ARHGEF11
  • Gene Alias:
  • DKFZp667F1223,GTRAP48,KIAA0380,PDZ-RHOGEF
  • Gene Description:
  • Rho guanine nucleotide exchange factor (GEF) 11
  • Gene Summary:
  • Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form a complex with G proteins and stimulate Rho-dependent signals. A similar protein in rat interacts with glutamate transporter EAAT4 and modulates its glutamate transport activity. Expression of the rat protein induces the reorganization of the actin cytoskeleton and its overexpression induces the formation of membrane ruffling and filopodia. Two alternative transcripts encoding different isoforms have been described. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000038716,OTTHUMP00000038717,Rho guanine exchange factor (GEF) 11,RhoA-specific guanine nucleotide exchange factor,RhoGEF glutamate transport modulator,glutamate transporter EAAT4-associated protein 48
  • RSS
  • YouTube
  • Linkedin
  • Facebook