ARMCX2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ARMCX2 partial ORF ( NP_055597, 508 a.a. - 599 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
NSIANFFRLLSQGGGKIKVEILKILSNFAENPDMLKKLLSTQVPASFSSLYNSYVESEILINALTLFEIIYDNLRAEVFNYREFNKGSLFYL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.86
Interspecies Antigen Sequence
Mouse (71); Rat (71)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ARMCX2
Entrez GeneID
9823GeneBank Accession#
NM_014782Protein Accession#
NP_055597Gene Name
ARMCX2
Gene Alias
ALEX2, KIAA0512, MGC13343, MGC8742
Gene Description
armadillo repeat containing, X-linked 2
Omim ID
300363Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the ALEX family of proteins and may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is closely localized with other family members, including ALEX1 and ALEX3, on the X chromosome. Two alternative transcripts that encode the same protein but differ in the 5' UTR have been described. Additional alternative transcripts may exist but their full length natures have not been determined. A pseudogene for this locus is located on chromosome 7. [provided by RefSeq
Other Designations
ALEX2 protein|OTTHUMP00000023695|OTTHUMP00000023697|arm protein lost in epithelial cancers, X chromosome, 2|armadillo repeat protein ALEX2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com