Product Browser

Last updated: 2017/11/19
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IHPK1 polyclonal antibody (A01)

  • Catalog # : H00009807-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant IHPK1.
  • Immunogen:
  • IHPK1 (NP_001006115, 182 a.a. ~ 275 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • ESCLDRRSEMRLKHLDMVLPEVASSCGPSTSPSNTSPEAGPSSQPKVDVRMIDFAHSTFKGFRDDPTVHDGPDRGYVFGLENLISIMEQMRDEN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009807-A01
    Western Blot detection against Immunogen (36.45 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9807
  • Gene Name:
  • IP6K1
  • Gene Alias:
  • IHPK1,MGC9925,PiUS
  • Gene Description:
  • inositol hexakisphosphate kinase 1
  • Gene Summary:
  • This gene encodes a protein that belongs to the inositol phosphokinase (IPK) family. This protein is likely responsible for the conversion of inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). It may also convert 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4. Alternative splicing occurs for this gene; however, the full-length nature of all transcript variants has not yet been described. [provided by RefSeq
  • Other Designations:
  • ATP:1D-myo-inositol-hexakisphosphate phosphotransferase,Pi uptake stimulator,inositol hexaphosphate kinase 1,insP6 kinase 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook