Product Browser

Last updated: 2017/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TOMM20 polyclonal antibody (A01)

  • Catalog # : H00009804-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant TOMM20.
  • Immunogen:
  • TOMM20 (AAH66335, 1 a.a. ~ 145 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009804-A01
    Western Blot detection against Immunogen (42.06 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TOMM20 polyclonal antibody (A01), Lot # 051129JC01 Western Blot analysis of TOMM20 expression in A-431 ( Cat # L015V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9804
  • Gene Name:
  • TOMM20
  • Gene Alias:
  • KIAA0016,MAS20,MGC117367,MOM19,TOM20
  • Gene Description:
  • translocase of outer mitochondrial membrane 20 homolog (yeast)
  • Other Designations:
  • OTTHUMP00000037593,translocase of outer mitochondrial membrane 20 homolog,translocase of outer mitochondrial membrane 20 homolog type II
  • RSS
  • YouTube
  • Linkedin
  • Facebook