MTSS1 monoclonal antibody (M01), clone 2G9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MTSS1.
Immunogen
MTSS1 (AAH23998, 346 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GVLPAPPDGPEERGEHSPESPSVGEGPQGVTSMPSSMWSGQASVNPPLPGPKPSIPEEHRQAIPESEAEDQEREPPSATVSPGQIPESDPADLSPRDTPQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (95)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
MTSS1 monoclonal antibody (M01), clone 2G9. Western Blot analysis of MTSS1 expression in human pancreas.Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MTSS1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MTSS1 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — MTSS1
-
Interactome
-
Disease
-
Publication Reference
-
Genes with dual proto-oncogene and tumor suppressor gene activities are frequently altered by protein losses in colon cancers.
Jae Woong Kim, Ha Yoon Mo, Hyun Ji Son, Nam Jin Yoo, Chang Hyeok Ann, Sug Hyung Lee.
Pathology, Research and Practice 2023 Aug; 248:154659.
Application:IHC-P, Human, Human colon cancer tissues.
-
Anti-miR182 Reduces Ovarian Cancer Burden, Invasion, and Metastasis: An In Vivo Study in Orthotopic Xenografts of Nude Mice.
Xu X, Ayub B, Liu Z, Serna VA, Qiang W, Liu Y, Hernando E, Zabludoff S, Kurita T, Kong B, Wei JJ.
Molecular Cancer Therapeutics 2014 Jul; 13(7):1729.
Application:WB-Ce, Human, SKOV3, OVCAR3 cells.
-
MTSS1 is a metastasis driver in a subset of human melanomas. (supplemental information is required)
Mertz KD, Pathria G, Wagner C, Saarikangas J, Sboner A, Romanov J, Gschaider M, Lenz F, Neumann F, Schreiner W, Nemethova M, Glassmann A, Lappalainen P, Stingl G, Small JV, Fink D, Chin L, Wagner SN.
Nature communications 2014 Mar; 5:3465.
Application:WB-Tr, Human, A-375, HMEL, UACC-257 cells.
-
The impact of Metastasis Suppressor-1, MTSS1, on oesophageal squamous cell carcinoma and its clinical significance.
Xie F, Ye L, Chen J, Wu N, Zhang Z, Yang Y, Zhang L, Jiang WG.
J Transl Med 2011 Jun; 9:95.
Application:WB-Ti, WB-Tr, Human, Oesophageal, KYSE150 cells.
-
Downregulation of metastasis suppressor 1(MTSS1) is associated with nodal metastasis and poor outcome in Chinese patients with gastric cancer.
Liu K, Wang G, Ding H, Chen Y, Yu G, Wang J.
BMC Cancer 2010 Aug; 10:428.
Application:IHC-P, WB-Ti, Human, Human gastric cancer, Tissue microarray.
-
Metastasis suppressor 1 (MTSS1) demonstrates prognostic value and anti-metastatic properties in breast cancer.
Parr C, Jiang WG.
European Journal of Cancer 2009 Jun; 45(9):1673.
Application:IHC-Fr, WB-Tr, Human, Human breast tumours, MCF-7, MDA-MB-435 cells, Normal breast tissues.
-
Genes with dual proto-oncogene and tumor suppressor gene activities are frequently altered by protein losses in colon cancers.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com