RNF144A purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human RNF144A protein.
Immunogen
RNF144A (NP_055561.2, 1 a.a. ~ 292 a.a) full-length human protein.
Sequence
MTTTRYRPTWDLALDPLVSCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVCQLQDVGLQTPQPVQCKACRMEFCSTCKASWHPGQGCPETMPITFLPGETSAAFKMEEDDAPIKRCPKCKVYIERDEGCAQMMCKNCKHAFCWYCLESLDDDFLLIHYDKGPCRNKLGHSRASVIWHRTQVVGIFAGFGLLLLVASPFLLLATPFVLCCKCKCSKGDDDPLPT
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (96); Rat (95)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
RNF144 MaxPab polyclonal antibody. Western Blot analysis of RNF144 expression in rat brain.Western Blot (Cell lysate)
RNF144A MaxPab polyclonal antibody. Western Blot analysis of RNF144A expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of RNF144A expression in transfected 293T cell line (H00009781-T02) by RNF144A MaxPab polyclonal antibody.
Lane 1: RNF144 transfected lysate(32.12 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to RNF144 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — RNF144A
Entrez GeneID
9781GeneBank Accession#
NM_014746.2Protein Accession#
NP_055561.2Gene Name
RNF144A
Gene Alias
KIAA0161, RNF144, UBCE7IP4
Gene Description
ring finger protein 144A
Gene Ontology
HyperlinkGene Summary
The protein encoded by this protein contains a RING finger, a motif known to be involved in protein-DNA and protein-protein interactions. The mouse counterpart of this protein has been shown to interact with Ube2l3/UbcM4, which is an ubiquitin-conjugating enzyme involved in embryonic development. [provided by RefSeq
Other Designations
OTTHUMP00000115411|UbcM4-interacting protein 4|ring finger protein 144|ubiquitin conjugating enzyme 7 interacting protein 4
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com