Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RAPGEF5 (Human) Recombinant Protein (Q01)

  • Catalog # : H00009771-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RAPGEF5 partial ORF ( AAH39203, 345 a.a. - 444 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • AYRDAFKKMKPPKIPFVPLLLKDVTFIHEGNKTFLDNLVNFEKLHMIADTVRTLRHCRTNQFGDLSPKEHQELKSYVNHLYVIDSQQALFELSHRIEPRV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009771-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9771
  • Gene Name:
  • RAPGEF5
  • Gene Alias:
  • GFR,KIAA0277,MR-GEF,REPAC
  • Gene Description:
  • Rap guanine nucleotide exchange factor (GEF) 5
  • Gene Summary:
  • Members of the RAS (see HRAS; MIM 190020) subfamily of GTPases function in signal transduction as GTP/GDP-regulated switches that cycle between inactive GDP- and active GTP-bound states. Guanine nucleotide exchange factors (GEFs), such as RAPGEF5, serve as RAS activators by promoting acquisition of GTP to maintain the active GTP-bound state and are the key link between cell surface receptors and RAS activation (Rebhun et al., 2000 [PubMed 10934204]).[supplied by OMIM
  • Other Designations:
  • M-Ras-regulated GEF,guanine nucleotide exchange factor for Rap1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook