KIAA0101 monoclonal antibody (M01), clone 3C11-1F11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant KIAA0101.
Immunogen
KIAA0101 (AAH05832, 1 a.a. ~ 111 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84); Rat (87)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.95 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to KIAA0101 on formalin-fixed paraffin-embedded human lymph node tissue. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KIAA0101 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to KIAA0101 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — KIAA0101
Entrez GeneID
9768GeneBank Accession#
BC005832Protein Accession#
AAH05832Gene Name
KIAA0101
Gene Alias
L5, NS5ATP9, OEATC-1, OEATC1, PAF, p15(PAF)
Gene Description
KIAA0101
Omim ID
610696Gene Ontology
HyperlinkOther Designations
hypothetical protein LOC9768|overexpressed in anaplastic thyroid carcinoma 1
-
Interactome
-
Publication Reference
-
PCNA-associated factor (KIAA0101/PCLAF) overexpression and gene copy number alterations in hepatocellular carcinoma tissues.
Anchalee Tantiwetrueangdet, Ravat Panvichian, Pattana Sornmayura, Surasak Leelaudomlipi, Jill A Macoska.
BMC Cancer 2021 Mar; 21(1):295.
Application:IHC, Human, Human hepatocellular carcinoma.
-
Overexpression of KIAA0101 Promotes the Progression of Non-small Cell Lung Cancer.
He Cao, Jing Zheng, Yinan Yao, Qi Yang, Runlan Yan, Wenjia Sun, Kexin Ruan, Jianya Zhou, Jianying Zhou.
Journal of Cancer 2020 Sep; 11(22):6663.
Application:IF, IHC-P, WB-Ce, WB-Tr, Human, A-549, H226, H1299 cells, Human non-small cell lung cancer, MRC-5, PC-9 cells.
-
MicroRNA-216a-5p suppresses esophageal squamous cell carcinoma progression by targeting KIAA0101.
Tuanhe Sun, Qi An, Rong Yan, Kang Li, Kun Zhu, Chengxue Dang, Dawei Yuan.
Oncology Reports 2020 Nov; 44(5):1971.
Application:IHC, WB-Ce, WB-Tr, Human, EC109, EC9706, HET1A, KYSE150, KYSE450 cells, Human esophageal squamous cell carcinoma, TE1, TE10 cells.
-
PAF promotes stemness and radioresistance of glioma stem cells.
Ong DST, Hu B, Ho YW, Sauvé CG, Bristow CA, Wang Q, Multani AS, Chen P, Nezi L, Jiang S, Gorman CE, Monasterio MM, Koul D, Marchesini M, Colla S, Jin EJ, Sulman EP, Spring DJ, Yung WA, Verhaak RGW, Chin L, Wang YA, DePinho RA.
PNAS 2017 Oct; 114(43):E9086.
Application:IF, IHC, WB, Human, Human glioma.
-
NS5ATP9 mRNA levels in peripheral blood mononuclear cells predict prognosis in patients with gastric cancer.
Yuan D, Zhu K, Dang C, Zheng Y, Yan R, Shi L, Li K.
Medical Oncology 2014 Aug; 31(8):106.
Application:WB-Ce, Human, PBMCs.
-
Expression of KIAA0101 protein is associated with poor survival of esophageal cancer patients and resistance to cisplatin treatment in vitro.
Cheng Y, Li K, Diao D, Zhu K, Shi L, Zhang H, Yuan D, Guo Q, Wu X, Liu D, Dang C.
Laboratory Investigation 2013 Dec; 93(12):1276.
Application:IHC-P, WB-Tr, Human, Esophageal cancer, Eca-109, TE-1 cells.
-
p15PAF Is an Rb/E2F-Regulated S-Phase Protein Essential for DNA Synthesis and Cell Cycle Progression.
Chang CN, Feng MJ, Chen YL, Yuan RH, Jeng YM.
PLoS One 2013 Apr; 8(4):e61196.
Application:IF, IHC-P, WB-Ce, WB-Tr, Human, HeLa, MCF-7 cells.
-
Elevated cyclin B2 expression in invasive breast carcinoma is associated with unfavorable clinical outcome.
Shubbar E, Kovacs A, Hajizadeh S, Parris TZ, Nemes S, Gunnarsdottir K, Einbeigi Z, Karlsson P, Helou K.
BMC Cancer 2013 Jan; 13:1.
Application:IHC, Human, Breast tumors.
-
Overexpression of KIAA0101 predicts poor prognosis in primary lung cancer patients.
Kato T, Daigo Y, Aragaki M, Ishikawa K, Sato M, Kaji M.
Lung Cancer 2012 Jan; 75(1):110.
Application:IHC, Human, Lung adenocarcinoma, Squamous cell carcinoma.
-
Overexpression of KIAA0101 Predicts High Stage, Early Tumor Recurrence, and Poor Prognosis of Hepatocellular Carcinoma.
Yuan RH, Jeng YM, Pan HW, Hu FC, Lai PL, Lee PH, Hsu HC.
Clinical Cancer Research 2007 Sep; 13(18):5368.
Application:IHC-P, Human, Human hepatocellular carcinoma, liver.
-
PCNA-associated factor (KIAA0101/PCLAF) overexpression and gene copy number alterations in hepatocellular carcinoma tissues.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com