Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KIAA0101 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00009768-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human KIAA0101 protein.
  • Immunogen:
  • KIAA0101 (NP_055551.1, 1 a.a. ~ 111 a.a) full-length human protein.
  • Sequence:
  • MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of KIAA0101 expression in transfected 293T cell line (H00009768-T01) by KIAA0101 MaxPab polyclonal antibody.

    Lane 1: KIAA0101 transfected lysate(12.32 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9768
  • Gene Name:
  • KIAA0101
  • Gene Alias:
  • L5,NS5ATP9,OEATC-1,OEATC1,PAF,p15(PAF)
  • Gene Description:
  • KIAA0101
  • Other Designations:
  • hypothetical protein LOC9768,overexpressed in anaplastic thyroid carcinoma 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook